Anti-DPYSL2 (Dihydropyrimidinase-related Protein 2, DRP-2, Collapsin Response Mediator Protein 2, CR

CRMP2 also regulates axon formation and branching by binding tubulin heterodimers thereby enhancing microtubule polymerisation. Through its interaction with ROKalpha, CRMP2 is also thought to play a role in RhoA-dependent signalling. CRMP2 is associated with mesial temporal lobe epilepsy and schizophrenia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.