Anti-DOG-1 / TMEM16A / ANO1

Anti-DOG-1 / TMEM16A / ANO1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4536 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Anoctamin-1 (ANO1), also known as oral... more
Product information "Anti-DOG-1 / TMEM16A / ANO1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Anoctamin-1 (ANO1), also known as oral cancer overexpressed 2 (ORAOV2) or tumor-amplified and overexpressed sequence 2 (TMEM16A), is a protein that in humans is encoded by the ANO1 gene. This gene belongs to a family of membrane proteins containing 8 transmembrane segments, and it is mapped to 11q13.3. TMEM16A is a candidate calcium-activated chloride channel that mediates receptor-activated chloride currents in diverse physiologic processes, and it is thought to be responsible for a voltage-sensitive calcium-activated chloride current. Its overexpression was reported in esophageal squamous cell carcinoma and breast cancer progression Crofelemer, an antidiarrhoeal, inhibits this channel. TMEM16A has eight transmembrane domains, its pore is large and non-selective, allowing other negatively charged species to permeate. Protein function: Calcium-activated chloride channel (CaCC) which plays a role in transepithelial anion transport and smooth muscle contraction. Required for the normal functioning of the interstitial cells of Cajal (ICCs) which generate electrical pacemaker activity in gastrointestinal smooth muscles. Acts as a major contributor to basal and stimulated chloride conductance in airway epithelial cells and plays an important role in tracheal cartilage development. [The UniProt Consortium]
Keywords: Anti-DOG1, Anti-ANO1, Anti-Anoctamin-1, Anti-Transmembrane protein 16A, Anti-Oral cancer overexpressed protein 2, Anti-Tumor-amplified and overexpressed sequence 2, Anti-Discovered on gastrointestinal stromal tumors protein 1, DOG-1 Antibody / TMEM16A / A
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4536

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids QQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDE
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-DOG-1 / TMEM16A / ANO1"
Write a review
or to review a product.
Viewed