Anti-DNA Polymerase iota / POLI

Anti-DNA Polymerase iota / POLI
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4298 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DNA polymerase iota is an enzyme that in... more
Product information "Anti-DNA Polymerase iota / POLI"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DNA polymerase iota is an enzyme that in humans is encoded by the POLI gene. The protein encoded by this gene is an error-prone DNA polymerase involved in DNA repair. The encoded protein promotes DNA synthesis across lesions in the template DNA, which other polymerases cannot do. The encoded polymerase inserts deoxynucleotides across lesions and then relies on DNA polymerase zeta to extend the nascent DNA strand to bypass the lesion. Protein function: Error-prone DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Favors Hoogsteen base-pairing in the active site. Inserts the correct base with high-fidelity opposite an adenosine template. Exhibits low fidelity and efficiency opposite a thymidine template, where it will preferentially insert guanosine. May play a role in hypermutation of immunogobulin genes. Forms a Schiff base with 5'-deoxyribose phosphate at abasic sites, but may not have lyase activity. [The UniProt Consortium]
Keywords: Anti-POLI, Anti-Eta2, Anti-RAD30B, EC=2.7.7.7, Anti-RAD30 homolog B, Anti-DNA polymerase iota, DNA Polymerase iota Antibody / POLI
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4298

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DIDPQVFYELPEAVQKELLAEWKRAGSDFHIGHK were used as the immunogen for the DNA Polymerase iota antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-DNA Polymerase iota / POLI"
Write a review
or to review a product.
Viewed