Anti-DDAH1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32437 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDAH1 is knowns as dimethylarginine... more
Product information "Anti-DDAH1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney. Protein function: Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. [The UniProt Consortium]
Keywords: Anti-DDAH, Anti-DDAHI, Anti-DDAH1, Anti-DDAH-1, EC=3.5.3.18, Anti-Dimethylargininase-1, Anti-Dimethylarginine dimethylaminohydrolase 1, Anti-N(G),N(G)-dimethylarginine dimethylaminohydrolase 1, DDAH1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32437

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-DDAH1"
Write a review
or to review a product.
Viewed