Anti-Cytokeratin 19, clone 3D4

Anti-Cytokeratin 19, clone 3D4
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4521 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratin, type I cytoskeletal 19 is a... more
Product information "Anti-Cytokeratin 19, clone 3D4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood. Protein function: Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle. [The UniProt Consortium]
Keywords: Anti-K19, Anti-CK-19, Anti-KRT19, Anti-Keratin-19, Anti-Cytokeratin-19, Anti-Keratin, type I cytoskeletal 19, Cytokeratin 19 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4521

Properties

Application: WB, IHC (paraffin)
Antibody Type: Monoclonal
Clone: 3D4
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Amino acids QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Cytokeratin 19, clone 3D4"
Write a review
or to review a product.
Viewed