Anti-Cytokeratin 19

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40282.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Involved in the organization of myofibers. Together with KRT8, helps to link... more

Close menu

Product information "Anti-Cytokeratin 19"

Protein function: Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle. [The UniProt Consortium]

Keywords:	Anti-K19, Anti-KRT19, Anti-CK-19, Anti-Keratin-19, Anti-Cytokeratin-19, Anti-Keratin, type I cytoskeletal 19
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40282

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 334-372 of Human Cytokeratin 19. (QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR)
MW:	44 kD
Format:	Antigen Affinity Purified