Anti-Cystatin SN

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58548.50	50 µl		-	-	6 - 14 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Human saliva appears to contain several cysteine proteinase inhibitors that are... more

Close menu

Product information "Anti-Cystatin SN"

Protein function: Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well. [The UniProt Consortium]

Keywords:	Anti-CST1, Anti-Cystatin-1, Anti-Cystatin-SN, Anti-Cystain-SA-I, Anti-Salivary cystatin-SA-1
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58548

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide around the Middle region of Human Cystatin SN. (within the following sequence: AISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPN)
MW:	15 kD
Format:	Affinity Purified