Anti-CYP27B1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31812 100 µg - -

3 - 10 business days*

772.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CYP27B1 belongs to the cytochrome P450... more
Product information "Anti-CYP27B1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I. Protein function: Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation. [The UniProt Consortium]
Keywords: Anti-CYP27B1, Anti-CYP1ALPHA, EC=1.14.13.13, Anti-VD3 1A hydroxylase, Anti-Cytochrome p450 27B1, Anti-Cytochrome P450C1 alpha, Anti-Cytochrome P450VD1-alpha, Anti-Calcidiol 1-monooxygenase, Anti-25-OHD-1 alpha-hydroxylase, CYP27B1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R31812

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR of human CYP27B1 were used as the immunogen for the CYP27B1 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CYP27B1"
Write a review
or to review a product.
Viewed