Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG42954.50 | 50 µg | - | - |
6 - 14 business days* |
551.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: A cytochrome P450 monooxygenase involved in vitamin D metabolism and in calcium... more
Product information "Anti-CYP27B1"
Protein function: A cytochrome P450 monooxygenase involved in vitamin D metabolism and in calcium and phosphorus homeostasis. Catalyzes the rate-limiting step in the activation of vitamin D in the kidney, namely the hydroxylation of 25-hydroxyvitamin D3/calcidiol at the C1alpha- position to form the hormonally active form of vitamin D3, 1alpha,25- dihydroxyvitamin D3/calcitriol that acts via the vitamin D receptor (VDR) (PubMed:10518789, PubMed:9486994, PubMed:22862690, PubMed:10566658, PubMed:12050193). Has 1alpha-hydroxylase activity on vitamin D intermediates of the CYP24A1-mediated inactivation pathway (PubMed:10518789, PubMed:22862690). Converts 24R,25-dihydroxyvitamin D3/secalciferol to 1-alpha,24,25-trihydroxyvitamin D3, an active ligand of VDR. Also active on 25-hydroxyvitamin D2 (PubMed:10518789). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via FDXR/adrenodoxin reductase and FDX1/adrenodoxin (PubMed:22862690). {ECO:0000269, PubMed:10518789, ECO:0000269, PubMed:10566658, ECO:0000269, PubMed:12050193, ECO:0000269, PubMed:22862690, ECO:0000269, PubMed:9486994}. [The UniProt Consortium]
| Keywords: | Anti-CYP27B1, Anti-CYP1ALPHA, Anti-VD3 1A hydroxylase, Anti-VD3 1A hydroxylase, Anti-Cytochrome p450 27B1, Anti-Cytochrome p450 27B1, Anti-Cytochrome P450C1 alpha, Anti-Cytochrome P450C1 alpha, Anti-Cytochrome P450VD1-alpha, Anti-Cytochrome P450VD1-alpha, |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG42954 |
Properties
| Application: | IHC (paraffin), WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | Synthetic peptide corresponding to aa. 475-508 of Human CYP27B1. (HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR) |
| MW: | 57 kD |
| Format: | Antigen Affinity Purified |
Database Information
| KEGG ID : | K07438 | Matching products |
| UniProt ID : | O15528 | Matching products |
| Gene ID : | GeneID 1594 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed