Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Promotion:
Save 30% on all primary antibodies by Arigo Biolaboratories!
*1
*1 Offer expires 16/12/2024
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Discount | Price |
---|---|---|---|---|---|---|---|---|
ARG58314.50 | 50 µg | - | - |
6 - 14 business days* |
30 %
|
520.00€
364.00€ |
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1)... more
Product information "Anti-Cyclin T1"
Protein function: Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). [The UniProt Consortium]
Keywords: | Anti-CCNT1, Anti-CycT1, Anti-Cyclin-T, Anti-Cyclin-T1 |
Supplier: | Arigo Biolaboratories |
Supplier-Nr: | ARG58314 |
Properties
Application: | IHC (paraffin), WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human, mouse, rat (Expected: bovine) |
Immunogen: | Synthetic peptide corresponding to a sequence in the middle region of Human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related Mouse sequence by one amino acid |
MW: | 81 kD |
Format: | Antigen Affinity Purified |
Database Information
KEGG ID : | K15188 | Matching products |
UniProt ID : | O60563 | Matching products |
Gene ID | GeneID 904 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed