Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced

Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced
Item number Size Datasheet Manual SDS Delivery time Quantity Price
C8297-98W.100 100 µg - -

3 - 19 business days*

715.00€
 
CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth,... more
Product information "Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced"
CXCL9 acts as a Th1 (type 1 helper T) cell chemoattractant, and plays a role in the growth, activation and movement of cells associated with immune and inflammatory responses, and in tumor growth inhibition and angiogenesis. Studies have shown that CXCL9 is active against E.coli, S.aureus, L. monocytogenes and S.pyogenes. Applications: Suitable for use in ELISA. Other applications have not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT , Storage and Stability:, May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: Anti-HuMIG, Anti-C-X-C motif chemokine 9, Anti-Small-inducible cytokine B9, Anti-Gamma-interferon-induced monokine, Anti-Monokine induced by interferon-gamma
Supplier: United States Biological
Supplier-Nr: C8297-98W

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 1F5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: CXCL9 (AAH63122, 23-126aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CXCL9 (C-X-C Motif Chemokine 9, CMK, Gamma-interferon-induced Monokine, Humig, Monokine Induced"
Write a review
or to review a product.
Viewed