Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4345 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High affinity copper uptake protein 1... more
Product information "Anti-CTR1 / Copper transporter 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper. Protein function: High-affinity, saturable copper transporter involved in dietary copper uptake. [The UniProt Consortium]
| Keywords: | Anti-hCTR1, Anti-COPT1, Anti-SLC31A1, Anti-Copper transporter 1, Anti-Solute carrier family 31 member 1, Anti-High affinity copper uptake protein 1, CTR1 Antibody / Copper transporter 1 |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4345 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Immunogen: | Amino acids NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ were used as the immunogen for the CTR1 antibody. |
| Format: | Purified |
Database Information
| KEGG ID : | K14686 | Matching products |
| UniProt ID : | O15431 | Matching products |
| Gene ID : | GeneID 1317 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed