Anti-CTR1 / Copper transporter 1

Anti-CTR1 / Copper transporter 1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4345 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High affinity copper uptake protein 1... more
Product information "Anti-CTR1 / Copper transporter 1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper. Protein function: High-affinity, saturable copper transporter involved in dietary copper uptake. [The UniProt Consortium]
Keywords: Anti-hCTR1, Anti-COPT1, Anti-SLC31A1, Anti-Copper transporter 1, Anti-Solute carrier family 31 member 1, Anti-High affinity copper uptake protein 1, CTR1 Antibody / Copper transporter 1
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4345

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ were used as the immunogen for the CTR1 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CTR1 / Copper transporter 1"
Write a review
or to review a product.
Viewed