Anti-CTNS

Anti-CTNS
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59641.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an... more
Product information "Anti-CTNS"
Protein function: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR. [The UniProt Consortium]
Keywords: Anti-Ctns, Anti-Cystinosin
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59641

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse (Expected: human, rat, bovine, dog, horse, swine, rabbit)
Immunogen: Synthetic peptide around the middle region of Mouse CTNS. (within the following region: GQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYP)
MW: 42 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CTNS"
Write a review
or to review a product.
Viewed