Anti-CSTF2 / CstF 64

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58549.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: One of the multiple factors required for polyadenylation and 3'-end cleavage of... more
Product information "Anti-CSTF2 / CstF 64"
Protein function: One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs. [The UniProt Consortium]
Keywords: Anti-CSTF2, Anti-CstF-64, Anti-CF-1 64 kDa subunit, Anti-CSTF 64 kDa subunit, Anti-Cleavage stimulation factor subunit 2, Anti-Cleavage stimulation factor 64 kDa subunit
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58549

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human CSTF2 / CstF 64. (within the following sequence: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA)
MW: 61 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CSTF2 / CstF 64"
Write a review
or to review a product.
Viewed