Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)

Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
125417.50 50 µg - -

3 - 19 business days*

850.00€
 
Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically... more
Product information "Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)"
Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 125417

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Full length human CST1, aa1-141 (NP_001889.2).
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CST1 (Cystatin-SN, Cystain-SA-I, Cystatin-1, Salivary Cystatin-SA-1)"
Write a review
or to review a product.
Viewed