Anti-CSRP3

Anti-CSRP3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41306.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Positive regulator of myogenesis. Acts as cofactor for myogenic bHLH... more
Product information "Anti-CSRP3"
Protein function: Positive regulator of myogenesis. Acts as cofactor for myogenic bHLH transcription factors such as MYOD1, and probably MYOG and MYF6. Enhances the DNA-binding activity of the MYOD1:TCF3 isoform E47 complex and may promote formation of a functional MYOD1:TCF3 isoform E47:MEF2A complex involved in myogenesis. Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation. The role in regulation of cytoskeleton dynamics by association with CFL2 is reported conflictingly: Shown to enhance CFL2-mediated F-actin depolymerization dependent on the CSRP3:CFL2 molecular ratio, and also shown to reduce the ability of CLF1 and CFL2 to enhance actin depolymerization (PubMed:19752190, PubMed:24934443). Proposed to contribute to the maintenance of muscle cell integerity through an actin-based mechanism. Can directly bind to actin filaments, cross-link actin filaments into bundles without polarity selectivity and protect them from dilution- and cofilin-mediated depolymerization, the function seems to involve its self-association (PubMed:24934443). In vitro can inhibit PKC/PRKCA activity (PubMed:27353086). Proposed to be involved in cardiac stress signaling by down-regulating excessive PKC/PRKCA signaling. [The UniProt Consortium]
Keywords: Anti-CLP, Anti-CRP3, Anti-CSRP3, Anti-Muscle LIM protein, Anti-Cardiac LIM protein, Anti-Cysteine-rich protein 3, Anti-LIM domain protein, cardiac, Anti-Cysteine and glycine-rich protein 3
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41306

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat (Expected: mouse, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human CSRP3. (within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG)
MW: 21 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CSRP3"
Write a review
or to review a product.
Viewed