Anti-CRP / C-Reactive Protein

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4555 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C Reactive Protein (CRP) is a major acute... more
Product information "Anti-CRP / C-Reactive Protein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver. Protein function: Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. [The UniProt Consortium]
Keywords: Anti-CRP, Anti-PTX1, CRP Antibody / C-Reactive Protein
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4555

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CRP / C-Reactive Protein"
Write a review
or to review a product.
Viewed