Anti-CRISPLD2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40152.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Promotes matrix assembly. [The UniProt Consortium] more
Product information "Anti-CRISPLD2"
Protein function: Promotes matrix assembly. [The UniProt Consortium]
Keywords: Anti-CRISP11, Anti-CRISPLD2, Anti-CRISP-11, Anti-Cysteine-rich secretory protein 11, Anti-Cysteine-rich secretory protein LCCL domain-containing 2, Anti-LCCL domain-containing cysteine-rich secretory protein 2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40152

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide around the N-terminal region of Human CRISPLD2. (within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA)
MW: 56 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CRISPLD2"
Write a review
or to review a product.
Viewed