Anti-CREB3L2 / BBF2H7

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG42600.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Transcription factor involved in unfolded protein response (UPR). In the... more
Product information "Anti-CREB3L2 / BBF2H7"
Protein function: Transcription factor involved in unfolded protein response (UPR). In the absence of endoplasmic reticulum (ER) stress, inserted into ER membranes, with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane. In response to ER stress, transported to the Golgi, where it is cleaved in a site-specific manner by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The released N-terminal cytosolic domain is translocated to the nucleus to effect transcription of specific target genes. Plays a critical role in chondrogenesis by activating the transcription of SEC23A, which promotes the transport and secretion of cartilage matrix proteins, and possibly that of ER biogenesis-related genes. In a neuroblastoma cell line, protects cells from ER stress-induced death (PubMed:17178827). In vitro activates transcription of target genes via direct binding to the CRE site (PubMed:17178827). [The UniProt Consortium]
Keywords: Anti-BBF2H7, Anti-CREB3L2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG42600

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human CREB3L2 / BBF2H7. (within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF)
MW: 57 kD
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CREB3L2 / BBF2H7"
Write a review
or to review a product.
Viewed