Anti-CORD2

Anti-CORD2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58427.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Transcription factor that binds and transactivates the sequence 5'-TAATC[CA]-3'... more
Product information "Anti-CORD2"
Protein function: Transcription factor that binds and transactivates the sequence 5'-TAATC[CA]-3' which is found upstream of several photoreceptor-specific genes, including the opsin genes. Acts synergistically with other transcription factors, such as NRL, RORB and RAX, to regulate photoreceptor cell-specific gene transcription. Essential for the maintenance of mammalian photoreceptors. [The UniProt Consortium]
Keywords: Anti-CRX, Anti-CORD2, Anti-Cone-rod homeobox protein
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58427

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide corresponding to a sequence at the C-terminus of Human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related Mouse and Rat sequences
MW: 32 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CORD2"
Write a review
or to review a product.
Viewed