Anti-Connexin 46 / GJA3

Anti-Connexin 46 / GJA3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32368 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction alpha-3 protein, also known... more
Product information "Anti-Connexin 46 / GJA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3). Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. [The UniProt Consortium]
Keywords: Anti-GJA3, Anti-Cx46, Anti-Connexin-46, Anti-Gap junction alpha-3 protein, Connexin 46 Antibody / GJA3
Supplier: NSJ Bioreagents
Supplier-Nr: R32368

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids TLIYLGHVLHIVRMEEKKKEREEEEQLKRE of human GJA3/Connexin 46 were used as the immunogen for the Connexin 46 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Connexin 46 / GJA3"
Write a review
or to review a product.
Viewed