Anti-Connexin 45 / GJC1

Anti-Connexin 45 / GJC1
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32083 100 µg - -

3 - 10 business days

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction gamma-1 protein (GJC1), also... more
Product information "Anti-Connexin 45 / GJC1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. [The UniProt Consortium]
Keywords: Anti-GJA7, Anti-Cx45, Anti-GJC1, Anti-Connexin-45, Anti-Gap junction alpha-7 protein, Anti-Gap junction gamma-1 protein, Connexin 45 Antibody / GJC1
Supplier-Nr: R32083


Application: WB
Antibody Type: Polyclonal
Host: Rabbit
Reactivity: Human, Rat
Immunogen: Amino acids ADLEALQREIRMAQERLDLAVQAYSHQNNP H of human Connexin 45/GJA7 were used as the immunogen for the Connexin 45 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Connexin 45 / GJC1"
Write a review
or to review a product.