Anti-Cofilin 2 / CFL2, clone 8C13

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ5498 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cofilin 2 (muscle), also known as CFL2, is... more
Product information "Anti-Cofilin 2 / CFL2, clone 8C13"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. Protein function: Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3 (PubMed:19752190). It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere. [The UniProt Consortium]
Keywords: Anti-CFL2, Anti-Cofilin-2, Anti-Cofilin, muscle isoform, Cofilin 2 Antibody / CFL2
Supplier: NSJ Bioreagents
Supplier-Nr: RQ5498

Properties

Application: WB, IHC (paraffin), ICC/IF, FC
Antibody Type: Monoclonal
Clone: 8C13
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Amino acids KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Cofilin 2 / CFL2, clone 8C13"
Write a review
or to review a product.
Viewed