Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R31811 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CLOCK (Circadian Locomotor Output Cycles... more
Product information "Anti-CLOCK"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CLOCK (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome. Alternative splicing results in multiple transcript variants.
| Keywords: | Anti-CLOCK, Anti-Class E basic helix-loop-helix protein 8, Anti-Circadian locomoter output cycles protein kaput, CLOCK Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R31811 |
Properties
| Application: | WB, IHC (paraffin), IF, FC |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat, monkey |
| Immunogen: | Amino acids QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE of human CLOCK |
| Format: | Purified |
Database Information
| KEGG ID : | K02223 | Matching products |
| UniProt ID : | O15516 | Matching products |
| Gene ID : | GeneID 9575 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed