Anti-Claudin 18

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41696.50	50 µl		-	-	6 - 14 business days*		584.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Plays a major role in tight junction-specific obliteration of the intercellular... more

Close menu

Product information "Anti-Claudin 18"

Protein function: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. [The UniProt Consortium]

Keywords:	Anti-CLDN18, Anti-Claudin-18
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41696

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, cow, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the C-terminal region of Human Claudin 18. (within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE)
MW:	28 kD
Format:	Affinity Purified