Anti-CHRNA3

Anti-CHRNA3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4415 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. After binding acetylcholine, Nicotinic... more
Product information "Anti-CHRNA3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt] Protein function: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [The UniProt Consortium]
Keywords: Anti-CHRNA3, Anti-NACHRA3, Anti-Neuronal acetylcholine receptor subunit alpha-3, CHRNA3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4415

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CHRNA3"
Write a review
or to review a product.
Viewed