Anti-CHM / REP1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG42590.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: Substrate-binding subunit of the Rab geranylgeranyltransferase (GGTase)... more
Product information "Anti-CHM / REP1"
Protein function: Substrate-binding subunit of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B composed of RABGGTA and RABGGTB, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Besides, a pre-formed complex consisting of CHM and the Rab GGTase dimer (RGGT or component B) can bind to and prenylate Rab proteins, this alternative pathway is proposed to be the predominant pathway for Rab protein geranylgeranylation. [The UniProt Consortium]
Keywords: Anti-CHM, Anti-REP1, Anti-REP-1, Anti-TCD protein, Anti-Rab escort protein 1, Anti-Choroideremia protein, Anti-Rab proteins geranylgeranyltransferase component A 1
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG42590

Properties

Application: FC, ICC, IF, IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human CHM / REP1. (QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED)
MW: 73 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CHM / REP1"
Write a review
or to review a product.
Viewed