Anti-CHM / Choroideremia protein

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4899 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Rab escort protein 1 (REP1) also known as... more
Product information "Anti-CHM / Choroideremia protein"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Rab escort protein 1 (REP1) also known as Rab proteins geranylgeranyltransferase component A 1, and Choroideremia protein, is an enzyme that in humans is encoded by the CHM gene. It is mapped to Xq21.2. This gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia, also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternatively spliced transcript variants have been found for this gene. Protein function: Substrate-binding subunit of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B composed of RABGGTA and RABGGTB, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Besides, a pre-formed complex consisting of CHM and the Rab GGTase dimer (RGGT or component B) can bind to and prenylate Rab proteins, this alternative pathway is proposed to be the predominant pathway for Rab protein geranylgeranylation. [The UniProt Consortium]
Keywords: Anti-CHM, Anti-REP1, Anti-REP-1, Anti-TCD protein, Anti-Rab escort protein 1, Anti-Choroideremia protein, Anti-Rab proteins geranylgeranyltransferase component A 1, CHM Antibody / Choroideremia protein
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4899

Properties

Application: WB, IHC (paraffin), IF, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QDQILENEEAIALSRKDKTIQHVEVFCYASQDLHED from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CHM / Choroideremia protein"
Write a review
or to review a product.
Viewed