Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P

Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P
Item number Size Datasheet Manual SDS Delivery time Quantity Price
124839.100 100 µg - -

5 - 10 business days*

850.00€
 
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to... more
Product information "Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P"
Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, elastase 3A has little elastolytic activity. Like most of the human elastases, elastase 3A is secreted from the pancreas as a zymogen and, like other serine proteases such as trypsin, chymotrypsin and kallikrein, it has a digestive function in the intestine. Elastase 3A preferentially cleaves proteins after alanine residues. Elastase 3A may also function in the intestinal transport and metabolism of cholesterol. Both elastase 3A and elastase 3B have been referred to as protease E and as elastase 1. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSGFGCNFIWKPTVFTRVSAFIDWIEETIASH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 124839

Properties

Application: ELISA, IHC, WB
Antibody Type: Monoclonal
Clone: 3G4
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

UniProt ID : P09093 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CELA3A (ELA3, ELA3A, Chymotrypsin-like Elastase Family Member 3A, Elastase IIIA, Elastase-3A, P"
Write a review
or to review a product.
Viewed