Anti-CDON (Cell Adhesion Molecule-related/Down-regulated by Oncogenes, CDO, MGC111524, ORCAM)

Anti-CDON (Cell Adhesion Molecule-related/Down-regulated by Oncogenes, CDO, MGC111524, ORCAM)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
124813.100 100 µg - -

5 - 10 business days*

850.00€
 
CDON and BOC (MIM 608708) are cell surface receptors of the immunoglobulin (Ig)/fibronectin type... more
Product information "Anti-CDON (Cell Adhesion Molecule-related/Down-regulated by Oncogenes, CDO, MGC111524, ORCAM)"
CDON and BOC (MIM 608708) are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII, see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIVSWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQQPRE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 124813

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2G12
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CDON (Cell Adhesion Molecule-related/Down-regulated by Oncogenes, CDO, MGC111524, ORCAM)"
Write a review
or to review a product.
Viewed