Anti-Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex S

Anti-Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex S
Item number Size Datasheet Manual SDS Delivery time Quantity Price
C2578-05.100 100 µg - -

3 - 19 business days*

699.00€
 
Applications: |Suitable for use in ELISA, Western Blot. Other applications not... more
Product information "Anti-Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex S"
Applications: , Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Western Blot: 0.1-10ug/ml, Optimal dilutions to be determined by the researcher. Hybridoma: Sp2/0 myeloma cells with spleen cells from Balb/c mice. Sequence: QQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY , Storage and Stability:, May be stored at 4°C for short-term only. For long-term storage and to avoid repeated freezing and thawing, add sterile 40-50% glycerol, aliquot and store at -20°C. Aliquots are stable for at least 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: EC=2.7.11.22, EC=2.7.11.23, Anti-Protein kinase K35, Anti-Cyclin-dependent kinase 8, Anti-Mediator complex subunit CDK8, Anti-Cell division protein kinase 8, Anti-Mediator of RNA polymerase II transcription subunit CDK8
Supplier: United States Biological
Supplier-Nr: C2578-05

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 6H5
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Recombinant protein corresponding to aa375-464 of human CDK8, partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Format: Affinity Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Cdk8 (Cyclin-dependent Kinase 8, Cdk 8, Cell Division Protein Kinase 8, K35, Mediator Complex S"
Write a review
or to review a product.
Viewed