Anti-CDC25C

Anti-CDC25C
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32057 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. M-phase inducer phosphatase 3is... more
Product information "Anti-CDC25C"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. M-phase inducer phosphatase 3is anenzymethat in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. Protein function: Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity. [The UniProt Consortium]
Keywords: Anti-CDC25C, EC=3.1.3.48, Anti-M-phase inducer phosphatase 3, Anti-Dual specificity phosphatase Cdc25C, CDC25C Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32057

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP of human CDC25C were used as the immunogen for the CDC25C antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CDC25C"
Write a review
or to review a product.
Viewed