Anti-CD5

Anti-CD5
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4028 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD5 is a member of the scavenger receptor... more
Product information "Anti-CD5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. Protein function: May act as a receptor in regulating T-cell proliferation. [The UniProt Consortium]
Keywords: Anti-CD5, Anti-LEU1, Anti-Lymphocyte antigen T1/Leu-1, Anti-T-cell surface glycoprotein CD5, CD5 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4028

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH from the human protein
Format: Immune Reaction

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD5"
Write a review
or to review a product.
Viewed