Anti-CD41 / ITGA2B

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31916 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Integrin alpha-IIb is a protein that in... more
Product information "Anti-CD41 / ITGA2B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling. Protein function: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha- IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface. [The UniProt Consortium]
Keywords: Anti-GP2B, Anti-ITGA2B, CD41 Antibody / ITGA2B
Supplier: NSJ Bioreagents
Supplier-Nr: R31916

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN of human ITGA2B/CD41 were used as the immunogen for the CD41 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD41 / ITGA2B"
Write a review
or to review a product.
Viewed