Anti-CD41

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41100.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen,... more
Product information "Anti-CD41"
Protein function: Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha- IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface. [The UniProt Consortium]
Keywords: Anti-GP2B, Anti-ITGA2B
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41100

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 677-711 of Human CD41. (EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN)
MW: 113 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD41"
Write a review
or to review a product.
Viewed