Anti-CD160 (CD160 Antigen, Natural Killer Cell Receptor BY55, BY55)

CD160 is a 27kD member of Ig superfamily of molecules. It is expressed on select hematopoietic cell types, including CD56dimCD16+ cytotoxic NK cells, CD8+CD28 effector T cells, YdT cells, and restricted CD4+ T cells. It is a receptor for HLAC molecules, and its engagement induces CD160+ NK cells to both secrete IFN-Y plus TNF-A, and initiate a cytotoxic program. Human CD160 was originally identified as a 155aa pro-protein aa27-181. It contains a 132aa mature region aa27-159 and a C-terminal pro-segment that is cleaved to create a GPI linkage. The mature region possesses one V-type Ig-like domain aa27-122. CD160 is found as a soluble, disulfide-linked 80kD multimer (likely trimer) that is generated by proteolysis of the GPI-linked form. This 80kD form, plus others, are highly resistant to reduction. There is also a 100-110kD multimeric transmembrane (TM) form that is associated with activated NK cells. It contains a 55aa substitution for aa180-181, and shows a 20aa TM segment between aa163- 182. The TM form appears to have a splice variant that lacks aa25-133. Over aa27-159, human CD160 shares only 62% aa sequence identity with mouse CD160. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.