Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| 124543.100 | 100 µg | - | - |
3 - 19 business days* |
943.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
CD160 is a 27kD member of Ig superfamily of molecules. It is expressed on select hematopoietic... more
Product information "Anti-CD160 (CD160 Antigen, Natural Killer Cell Receptor BY55, BY55)"
CD160 is a 27kD member of Ig superfamily of molecules. It is expressed on select hematopoietic cell types, including CD56dimCD16+ cytotoxic NK cells, CD8+CD28 effector T cells, YdT cells, and restricted CD4+ T cells. It is a receptor for HLAC molecules, and its engagement induces CD160+ NK cells to both secrete IFN-Y plus TNF-A, and initiate a cytotoxic program. Human CD160 was originally identified as a 155aa pro-protein aa27-181. It contains a 132aa mature region aa27-159 and a C-terminal pro-segment that is cleaved to create a GPI linkage. The mature region possesses one V-type Ig-like domain aa27-122. CD160 is found as a soluble, disulfide-linked 80kD multimer (likely trimer) that is generated by proteolysis of the GPI-linked form. This 80kD form, plus others, are highly resistant to reduction. There is also a 100-110kD multimeric transmembrane (TM) form that is associated with activated NK cells. It contains a 55aa substitution for aa180-181, and shows a 20aa TM segment between aa163- 182. The TM form appears to have a splice variant that lacks aa25-133. Over aa27-159, human CD160 shares only 62% aa sequence identity with mouse CD160. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
| Supplier: | United States Biological |
| Supplier-Nr: | 124543 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human |
| Format: | Affinity Purified |
Database Information
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed