Anti-CD133 / PROM1 (C-Terminal Region)

Anti-CD133 / PROM1 (C-Terminal Region)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32909 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Prominin-1, also known as CD133, is a... more
Product information "Anti-CD133 / PROM1 (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans. Protein function: May play a role in cell differentiation, proliferation and apoptosis (PubMed:24556617). Binds cholesterol in cholesterol- containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner (PubMed:20818439). [The UniProt Consortium]
Keywords: Anti-PROM1, Anti-CD133, Anti-PROML1, Anti-MSTP061, Anti-Prominin-1, Anti-Antigen AC133, Anti-Prominin-like protein 1, CD133 Antibody / PROM1 (C-Terminal Region)
Supplier: NSJ Bioreagents
Supplier-Nr: R32909

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 808-841 (ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN)
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD133 / PROM1 (C-Terminal Region)"
Write a review
or to review a product.
Viewed