Anti-CD119 / IFN gamma R1

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40369.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Associates with IFNGR2 to form a receptor for the cytokine interferon gamma... more

Close menu

Product information "Anti-CD119 / IFN gamma R1"

Protein function: Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:7615558, PubMed:2971451, PubMed:7617032, PubMed:10986460). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:7673114). Plays an essential role in the IFN-gamma pathway that is required for the cellular response to infectious agents (PubMed:20015550). [The UniProt Consortium]

Keywords:	Anti-CD119, Anti-CDw119, Anti-IFN-gamma-R1, Anti-IFN-gamma-R-alpha, Anti-IFN-gamma receptor 1, Anti-Interferon gamma receptor 1, Anti-Interferon gamma receptor alpha-chain
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40369

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human
Immunogen:	Synthetic peptide corresponding to aa. 108-147 of Human CD119 / IFN gamma R1. (QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH)
MW:	54 kD
Format:	Antigen Affinity Purified