Anti-CD105 / Endoglin

Anti-CD105 / Endoglin
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40196.50 50 µg - -

6 - 14 business days*

520.00€
 
Protein function: Vascular endothelium glycoprotein that plays an important role in the... more
Product information "Anti-CD105 / Endoglin"
Protein function: Vascular endothelium glycoprotein that plays an important role in the regulation of angiogenesis (PubMed:21737454, PubMed:23300529). Required for normal structure and integrity of adult vasculature (PubMed:7894484). Regulates the migration of vascular endothelial cells (PubMed:17540773). Required for normal extraembryonic angiogenesis and for embryonic heart development. May regulate endothelial cell shape changes in response to blood flow, which drive vascular remodeling and establishment of normal vascular morphology during angiogenesis. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors (PubMed:1692830). Acts as TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade that ultimately leads to the activation of SMAD transcription factors (PubMed:8370410, PubMed:21737454, PubMed:22347366, PubMed:23300529). Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGFB1 signaling through SMAD3 (PubMed:21737454, PubMed:22347366, PubMed:23300529). [The UniProt Consortium]
Keywords: Anti-ENG, Anti-END, Anti-CD105, Anti-Endoglin
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40196

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 258-297 of Human CD105 / Endoglin. (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ)
MW: 71 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CD105 / Endoglin"
Write a review
or to review a product.
Viewed