Anti-CCR3

Anti-CCR3
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4331 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C-C chemokine receptor type 3, also called... more
Product information "Anti-CCR3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described. Protein function: Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection. [The UniProt Consortium]
Keywords: Anti-CCR3, Anti-CKR3, Anti-CD193, Anti-CCR-3, Anti-CMKBR3, Anti-CC-CKR-3, Anti-C-C CKR-3, Anti-Eosinophil eotaxin receptor, Anti-C-C chemokine receptor type 3, CCR3 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4331

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA were used as the immunogen for the CCR3 antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CCR3"
Write a review
or to review a product.
Viewed