Anti-CCR10

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4906 100 µg - -

7 - 12 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C-C chemokine receptor type 10 is a... more
Product information "Anti-CCR10"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. C-C chemokine receptor type 10 is a protein that in humans is encoded by the CCR10 gene. It is mapped to 17q21.2. Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues, the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CCR10 is the receptor for CCL27 (SCYA27, MIM 604833), CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation. Protein function: Receptor for chemokines SCYA27 and SCYA28. Subsequently transduces a signal by increasing the intracellular calcium ions level and stimulates chemotaxis in a pre-B cell line. [The UniProt Consortium]
Keywords: Anti-GPR2, Anti-CCR10, Anti-CCR-10, Anti-CC-CKR-10, Anti-C-C CKR-10, Anti-G-protein coupled receptor 2, Anti-C-C chemokine receptor type 10, CCR10 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4906

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CCR10"
Write a review
or to review a product.
Viewed