Anti-CCDC6

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
NSJ-R32518	100 µg		-	-	7 - 12 business days*		790.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Coiled-coil domain-containing protein 6 is... more

Close menu

Product information "Anti-CCDC6"

0.5mg/ml if reconstituted with 0.2ml sterile DI water. Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

Keywords:	Anti-CCDC6, Anti-D10S170, Anti-Protein H4, Anti-Coiled-coil domain-containing protein 6, Anti-Papillary thyroid carcinoma-encoded protein, CCDC6 Antibody
Supplier:	NSJ Bioreagents
Supplier-Nr:	R32518

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein
Format:	Purified