Anti-CAT (Catalase, MGC138422, MGC138424)

Anti-CAT (Catalase, MGC138422, MGC138424)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
124371.100 100 µg - -

3 - 19 business days*

715.00€
 
Catalase is known marker for peroxisomes. It is the most abundant protein in the peroxisomes. It... more
Product information "Anti-CAT (Catalase, MGC138422, MGC138424)"
Catalase is known marker for peroxisomes. It is the most abundant protein in the peroxisomes. It is present in all aerobically respiring organisms. It protects cells form the toxicity of hydrogen peroxide. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 124371

Properties

Application: ELISA, WB
Antibody Type: Monoclonal
Clone: 2G6
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa1-100 from human CAT (NP_001743) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CAT (Catalase, MGC138422, MGC138424)"
Write a review
or to review a product.
Viewed