Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P

Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P
Item number Size Datasheet Manual SDS Delivery time Quantity Price
124362.100 100 µg - -

5 - 10 business days*

850.00€
 
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase)... more
Product information "Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P"
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family and is a downstream effector cysteine protease in the apoptotic pathway. It is made of two subunits, p20 and p11, which form the active complex. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is related to mammalian interleukin-1 converting enzyme (ICE) and to its Caenorhabditis elegans homologue, CED-3. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein. It is ubiquitously expressed in normal Human tissues including the liver, spleen, heart, liver and kidney. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 124362

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 4D3
Conjugate: No
Host: Mouse
Species reactivity: human
Format: Affinity Purified

Database Information

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Caspase 3 (Caspase-3, CASP3, CASP-3, Apopain, Cysteine Protease CPP32, CPP32, CPP-32, CPP32B, P"
Write a review
or to review a product.
Viewed