Anti-Carboxypeptidase A

Anti-Carboxypeptidase A
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4145 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Carboxypeptidase A1 is an enzyme that in... more
Product information "Anti-Carboxypeptidase A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer. Protein function: Carboxypeptidase that catalyzes the release of a C- terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. [The UniProt Consortium]
Keywords: Anti-CPA, Anti-CPA1, EC=3.4.17.1, Anti-Carboxypeptidase A1, Carboxypeptidase A Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4145

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: mouse, rat
Immunogen: Amino acids KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD from the human protein were used as the immunogen for the Carboxypeptidase A antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Carboxypeptidase A"
Write a review
or to review a product.
Viewed