Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-RQ4462 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Calcitonin, also known as CALCA, is a... more
Product information "Anti-Calcitonin / CALCA / CGRP"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones. [The UniProt Consortium]
| Keywords: | Anti-Calc, Anti-Calca, Anti-Calcitonin, Calcitonin Antibody / CALCA / CGRP |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | RQ4462 |
Properties
| Application: | IHC (paraffin) |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | mouse, rat |
| Immunogen: | Amino acids CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP |
| Format: | Purified |
Database Information
| UniProt ID : | P70160 | Matching products |
| Gene ID : | GeneID 12310 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed