Anti-CA4 / Carbonic Anhydrase 4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58375.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate... more
Product information "Anti-CA4 / Carbonic Anhydrase 4"
Protein function: Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid. [The UniProt Consortium]
Keywords: Anti-CA4, Anti-CA-IV, EC=4.2.1.1, Anti-Carbonic anhydrase 4, Anti-Carbonic anhydrase IV, Anti-Carbonate dehydratase IV
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58375

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the C-terminal region of Human CA4. (within the following sequence: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG)
MW: 34 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CA4 / Carbonic Anhydrase 4"
Write a review
or to review a product.
Viewed