Anti-Butyrylcholinesterase

Anti-Butyrylcholinesterase
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG41412.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Esterase with broad substrate specificity. Contributes to the inactivation of... more
Product information "Anti-Butyrylcholinesterase"
Protein function: Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters. [The UniProt Consortium]
Keywords: Anti-CHE1, Anti-BCHE, EC=3.1.1.8, Anti-Cholinesterase, Anti-Choline esterase II, Anti-Pseudocholinesterase, Anti-Butyrylcholine esterase, Anti-Acylcholine acylhydrolase
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG41412

Properties

Application: IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit, sheep)
Immunogen: Synthetic peptide around the N-terminal region of Human Butyrylcholinesterase. (within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ)
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Butyrylcholinesterase"
Write a review
or to review a product.
Viewed