Anti-Butyrylcholinesterase

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG41412.50	50 µl		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Esterase with broad substrate specificity. Contributes to the inactivation of... more

Close menu

Product information "Anti-Butyrylcholinesterase"

Protein function: Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters. [The UniProt Consortium]

Keywords:	Anti-CHE1, Anti-BCHE, EC=3.1.1.8, Anti-Cholinesterase, Anti-Choline esterase II, Anti-Pseudocholinesterase, Anti-Butyrylcholine esterase, Anti-Acylcholine acylhydrolase
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG41412

Properties

Application:	IHC (paraffin)
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit, sheep)
Immunogen:	Synthetic peptide around the N-terminal region of Human Butyrylcholinesterase. (within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ)
Format:	Purified