Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
B3000-08A.100 | 100 µl | - | - |
3 - 19 business days* |
744.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Bone marrow stromal Antigen-2 (BST-2) is a 30-36kD type II transmembrane protein, consisting of... more
Product information "Anti-BST2 (Bone Marrow Stromal Antigen 2, BST-2, HM1.24 Antigen, Tetherin, CD317)"
Bone marrow stromal Antigen-2 (BST-2) is a 30-36kD type II transmembrane protein, consisting of 180aa. BST-2 protein is expressed on certain bone marrow stromal cell lines and on various normal tissues. The expression pattern of BST2 is relatively different form another bone marrow stromal antigen 1 (BST1). The BST-2 gene is located on chromosome 19p13.2. BST-2 surface expression on fibroblast cell lines facilitated the stromal cell-dependent growth of a murine bone marrow-derived pre-B-cell line, DW34. Some studies suggest that BST-2 may be involved in pre-B-cell growth development by regulating their surface molecules and cytokines. BST2 is also expressed in bone marrow stromal cell lines and synovial cell lines from where the BST2 gene was cloned. BST2 is predominantly expressed in liver, lungs, heart, placenta and lower levels in pancreas, kidney, skeletal muscle and brain. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Western Blot: 1:500-1:1000 detects a band of ~19.77kD using Jurkat lysate and human liver lysate., Optimal dilutions to be determined by the researcher. AA Sequence: MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANS, EACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: | Anti-HM1.24 antigen, Anti-Bone marrow stromal antigen 2 |
Supplier: | United States Biological |
Supplier-Nr: | B3000-08A |
Properties
Application: | IP, WB |
Antibody Type: | Polyclonal |
Conjugate: | No |
Host: | Rabbit |
Species reactivity: | human |
Immunogen: | BST2 (NP_004326.1, 1-180aa) full-length human protein. |
Format: | Serum |
Database Information
KEGG ID : | K06731 | Matching products |
UniProt ID : | Q10589 | Matching products |
Gene ID | GeneID 684 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed