Anti-BST2 (Bone Marrow Stromal Antigen 2, BST-2, HM1.24 Antigen, Tetherin, CD317)

Bone marrow stromal Antigen-2 (BST-2) is a 30-36kD type II transmembrane protein, consisting of 180aa. BST-2 protein is expressed on certain bone marrow stromal cell lines and on various normal tissues. The expression pattern of BST2 is relatively different form another bone marrow stromal antigen 1 (BST1). The BST-2 gene is located on chromosome 19p13.2. BST-2 surface expression on fibroblast cell lines facilitated the stromal cell-dependent growth of a murine bone marrow-derived pre-B-cell line, DW34. Some studies suggest that BST-2 may be involved in pre-B-cell growth development by regulating their surface molecules and cytokines. BST2 is also expressed in bone marrow stromal cell lines and synovial cell lines from where the BST2 gene was cloned. BST2 is predominantly expressed in liver, lungs, heart, placenta and lower levels in pancreas, kidney, skeletal muscle and brain. Applications: Suitable for use in Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Western Blot: 1:500-1:1000 detects a band of ~19.77kD using Jurkat lysate and human liver lysate., Optimal dilutions to be determined by the researcher. AA Sequence: MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANS, EACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.